PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_A69F6C5DF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 285aa    MW: 30338.9 Da    PI: 6.9471
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_A69F6C5DF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46e-33127184259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp+vv++tYeg+H h+
  Traes_2BL_A69F6C5DF.1 127 EDGYRWRKYGQKAVKNSPFPRSYYRCTNNKCTVKKRVERSSEDPSVVITTYEGQHCHH 184
                            8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-33111185IPR003657WRKY domain
SuperFamilySSF1182902.88E-28118184IPR003657WRKY domain
PROSITE profilePS5081129.528121186IPR003657WRKY domain
SMARTSM007741.2E-38126185IPR003657WRKY domain
PfamPF031066.1E-26127184IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAGVECGGGD WPFSAEEAYA DSSALLAEIG WAAGFVDDGC AGELLPPLDP HPATPAGSME  60
GAGASSSSTD DGATREAADA DGRPAAATEA ASKTAPAPAP GKTMKKQKRA RQPRFAFMTK  120
TEIDHLEDGY RWRKYGQKAV KNSPFPRSYY RCTNNKCTVK KRVERSSEDP SVVITTYEGQ  180
HCHHTVTFPR GAGAATLASQ MAFSAHHHHL MYNDLPALHS PTTQNPLFSV PAMSSSLLQP  240
LHCNRQELQV ASYTTQASSI SSPGSVPAVD KGLLDDMVPP AMRHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25116183774Probable WRKY transcription factor 4
2lex_A1e-25116183774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418596e-78AY341859.1 Oryza sativa (japonica cultivar-group) WRKY19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658215.11e-101PREDICTED: probable WRKY transcription factor 57
TrEMBLW5BDM00.0W5BDM0_WHEAT; Uncharacterized protein
STRINGMLOC_58026.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.24e-54WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]